Lineage for d5z85o1 (5z85 O:1-90)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629590Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 2629591Protein automated matches [226999] (2 species)
    not a true protein
  7. 2629592Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries)
  8. 2629600Domain d5z85o1: 5z85 O:1-90 [356251]
    Other proteins in same PDB: d5z85a_, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_
    automated match to d3ag3b1
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85o1

PDB Entry: 5z85 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5z85o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z85o1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5z85o1:

Click to download the PDB-style file with coordinates for d5z85o1.
(The format of our PDB-style files is described here.)

Timeline for d5z85o1: