![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
![]() | Protein automated matches [226999] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries) |
![]() | Domain d5z85o1: 5z85 O:1-90 [356251] Other proteins in same PDB: d5z85a_, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ automated match to d3ag3b1 complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z85 (more details), 1.85 Å
SCOPe Domain Sequences for d5z85o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z85o1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d5z85o1: