SCOPe 2.07: Domain d5z85x_: 5z85 X:

Lineage for d5z85x_ (5z85 X:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (25 PDB entries)

8. Domain d5z85x_: 5z85 X: [356243]
   Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85y_, d5z85z_
   automated match to d1v54k_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85x_

PDB Entry: 5z85, 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days

PDB Compounds: (X:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5z85x_:

Sequence; same for both SEQRES and ATOM records:

>d5z85x_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d5z85x_:

• d5z85x_ is new in SCOPe 2.07-stable
  
• d5z85x_ appears in the current release, SCOPe 2.08