Lineage for d1g21d_ (1g21 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912508Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (4 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 2912509Species Azotobacter vinelandii [TaxId:354] [81397] (39 PDB entries)
  8. 2912592Domain d1g21d_: 1g21 D: [35624]
    Other proteins in same PDB: d1g21a_, d1g21c_, d1g21e_, d1g21f_, d1g21g_, d1g21h_
    complexed with atp, ca, cfm, clf, hca, mg, sf4

Details for d1g21d_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (D:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d1g21d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21d_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d1g21d_:

Click to download the PDB-style file with coordinates for d1g21d_.
(The format of our PDB-style files is described here.)

Timeline for d1g21d_: