Lineage for d5zcqm_ (5zcq M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025475Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 3025476Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 3025537Protein automated matches [190273] (1 species)
    not a true protein
  7. 3025538Species Cow (Bos taurus) [TaxId:9913] [187065] (26 PDB entries)
  8. 3025557Domain d5zcqm_: 5zcq M: [356225]
    Other proteins in same PDB: d5zcqa_, d5zcqb1, d5zcqb2, d5zcqc_, d5zcqd_, d5zcqe_, d5zcqf_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqn_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqq_, d5zcqr_, d5zcqs_, d5zcqt_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_
    automated match to d1v54m_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqm_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (M:) cytochrome c oxidase subunit 8b, mitochondrial

SCOPe Domain Sequences for d5zcqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d5zcqm_:

Click to download the PDB-style file with coordinates for d5zcqm_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqm_: