Lineage for d5z86b1 (5z86 B:1-90)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629590Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 2629591Protein automated matches [226999] (2 species)
    not a true protein
  7. 2629592Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries)
  8. 2629595Domain d5z86b1: 5z86 B:1-90 [356221]
    Other proteins in same PDB: d5z86a_, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_
    automated match to d3ag3b1
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z86b1

PDB Entry: 5z86 (more details), 1.85 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 3 days
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5z86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z86b1 f.17.2.0 (B:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5z86b1:

Click to download the PDB-style file with coordinates for d5z86b1.
(The format of our PDB-style files is described here.)

Timeline for d5z86b1: