Lineage for d1g21b_ (1g21 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75090Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 75106Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 75119Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 75120Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 75121Species Azotobacter vinelandii [TaxId:354] [53819] (5 PDB entries)
  8. 75139Domain d1g21b_: 1g21 B: [35622]
    Other proteins in same PDB: d1g21e_, d1g21f_, d1g21g_, d1g21h_

Details for d1g21b_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (B:)

SCOP Domain Sequences for d1g21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1g21b_:

Click to download the PDB-style file with coordinates for d1g21b_.
(The format of our PDB-style files is described here.)

Timeline for d1g21b_: