SCOPe 2.07: Domain d5z85c_: 5z85 C:

Lineage for d5z85c_ (5z85 C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)

8. Domain d5z85c_: 5z85 C: [356205]
   Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_
   automated match to d2occc_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85c_

PDB Entry: 5z85, 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5z85c_:

Sequence; same for both SEQRES and ATOM records:

>d5z85c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5z85c_:

• d5z85c_ is new in SCOPe 2.07-stable
  
• d5z85c_ appears in the current release, SCOPe 2.08