| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
| Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
| Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
| Domain d5z85c_: 5z85 C: [356205] Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85n_, d5z85o1, d5z85o2, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ automated match to d2occc_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z85 (more details), 1.85 Å
SCOPe Domain Sequences for d5z85c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z85c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs
Timeline for d5z85c_:
View in 3DDomains from other chains: (mouse over for more information) d5z85a_, d5z85b1, d5z85b2, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85n_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ |