Lineage for d5zcqg_ (5zcq G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024939Domain d5zcqg_: 5zcq G: [356193]
    Other proteins in same PDB: d5zcqa_, d5zcqb1, d5zcqb2, d5zcqc_, d5zcqd_, d5zcqe_, d5zcqf_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqo1, d5zcqo2, d5zcqp_, d5zcqq_, d5zcqr_, d5zcqs_, d5zcqu_, d5zcqv_, d5zcqw_, d5zcqx_, d5zcqy_, d5zcqz_
    automated match to d3ag3g_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqg_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d5zcqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d5zcqg_:

Click to download the PDB-style file with coordinates for d5zcqg_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqg_: