Lineage for d5zisc_ (5zis C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336229Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2336230Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2336231Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2336356Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2336357Species Bacillus megaterium [TaxId:1348623] [342557] (8 PDB entries)
  8. 2336387Domain d5zisc_: 5zis C: [356186]
    automated match to d2x7ya_
    complexed with mnh

Details for d5zisc_

PDB Entry: 5zis (more details), 3.1 Å

PDB Description: crystal structure of mn-protoporphyrinix-reconstituted p450bm3
PDB Compounds: (C:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5zisc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zisc_ a.104.1.1 (C:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1348623]}
empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
esrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdia
vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5zisc_:

Click to download the PDB-style file with coordinates for d5zisc_.
(The format of our PDB-style files is described here.)

Timeline for d5zisc_: