| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
| Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
| Protein automated matches [190271] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries) |
| Domain d5z86h_: 5z86 H: [356179] Other proteins in same PDB: d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ automated match to d1v54h_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z86 (more details), 1.85 Å
SCOPe Domain Sequences for d5z86h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z86h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki
Timeline for d5z86h_:
View in 3DDomains from other chains: (mouse over for more information) d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ |