SCOPe 2.07: Domain d6cpja1: 6cpj A:525-584

Lineage for d6cpja1 (6cpj A:525-584)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (5 PDB entries)

8. Domain d6cpja1: 6cpj A:525-584 [356175]
   Other proteins in same PDB: d6cpja2
   automated match to d1m27c_

Details for d6cpja1

PDB Entry: 6cpj

PDB Description: solution structure of sh3 domain from shank2

PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains protein 2

SCOPe Domain Sequences for d6cpja1:

Sequence; same for both SEQRES and ATOM records:

>d6cpja1 b.34.2.0 (A:525-584) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvpgrlfvaikpyqpqvdgeiplhrgdrvkvlsigeggfwegsarghigwfpaecveevq

Timeline for d6cpja1:

• d6cpja1 is new in SCOPe 2.07-stable
  
• d6cpja1 appears in the current release, SCOPe 2.08