Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries) |
Domain d5z86s_: 5z86 S: [356171] Other proteins in same PDB: d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ automated match to d3ag3f_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z86 (more details), 1.85 Å
SCOPe Domain Sequences for d5z86s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z86s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d5z86s_:
View in 3D Domains from other chains: (mouse over for more information) d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ |