Lineage for d1n2ca_ (1n2c A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127919Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 127935Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 127948Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 127949Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 127950Species Azotobacter vinelandii [TaxId:354] [53819] (5 PDB entries)
  8. 127963Domain d1n2ca_: 1n2c A: [35617]
    Other proteins in same PDB: d1n2ce_, d1n2cf_, d1n2cg_, d1n2ch_

Details for d1n2ca_

PDB Entry: 1n2c (more details), 3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp-tetrafluoroaluminate
PDB Compounds: (A:)

SCOP Domain Sequences for d1n2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ca_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea

SCOP Domain Coordinates for d1n2ca_:

Click to download the PDB-style file with coordinates for d1n2ca_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ca_: