Lineage for d5zcaa1 (5zca A:8-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913670Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2913677Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries)
  8. 2913680Domain d5zcaa1: 5zca A:8-389 [356162]
    Other proteins in same PDB: d5zcaa2
    automated match to d5b3xa_
    complexed with cit

    has additional insertions and/or extensions that are not grouped together

Details for d5zcaa1

PDB Entry: 5zca (more details), 1.8 Å

PDB Description: crystal structure of lambda repressor (1-20) fused with maltose- binding protein
PDB Compounds: (A:) Repressor protein cI,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5zcaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcaa1 c.94.1.1 (A:8-389) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
tqeqledarrlkagsgkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkle
ekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkli
aypiavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaad
ggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetam
tingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyl
ltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavr
tavinaasgrqtvdealkdaqt

SCOPe Domain Coordinates for d5zcaa1:

Click to download the PDB-style file with coordinates for d5zcaa1.
(The format of our PDB-style files is described here.)

Timeline for d5zcaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcaa2