Lineage for d1g20d_ (1g20 D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127919Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 127935Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 127948Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 127949Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 127950Species Azotobacter vinelandii [TaxId:354] [53819] (5 PDB entries)
  8. 127962Domain d1g20d_: 1g20 D: [35616]
    Other proteins in same PDB: d1g20e_, d1g20f_, d1g20g_, d1g20h_

Details for d1g20d_

PDB Entry: 1g20 (more details), 2.2 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (D:)

SCOP Domain Sequences for d1g20d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g20d_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1g20d_:

Click to download the PDB-style file with coordinates for d1g20d_.
(The format of our PDB-style files is described here.)

Timeline for d1g20d_: