Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Sphingobium herbicidovorans [TaxId:76947] [355993] (3 PDB entries) |
Domain d6d3mj_: 6d3m J: [356149] automated match to d1otjb_ complexed with akg, cl, co, ftj |
PDB Entry: 6d3m (more details), 2.03 Å
SCOPe Domain Sequences for d6d3mj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d3mj_ b.82.2.0 (J:) automated matches {Sphingobium herbicidovorans [TaxId: 76947]} nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
Timeline for d6d3mj_: