Lineage for d6d3mj_ (6d3m J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2816511Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2816512Protein automated matches [191281] (21 species)
    not a true protein
  7. 2816631Species Sphingobium herbicidovorans [TaxId:76947] [355993] (3 PDB entries)
  8. 2816639Domain d6d3mj_: 6d3m J: [356149]
    automated match to d1otjb_
    complexed with akg, cl, co, ftj

Details for d6d3mj_

PDB Entry: 6d3m (more details), 2.03 Å

PDB Description: ft_t dioxygenase with bound quizalofop
PDB Compounds: (J:) FT_T dioxygenase

SCOPe Domain Sequences for d6d3mj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d3mj_ b.82.2.0 (J:) automated matches {Sphingobium herbicidovorans [TaxId: 76947]}
nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr

SCOPe Domain Coordinates for d6d3mj_:

Click to download the PDB-style file with coordinates for d6d3mj_.
(The format of our PDB-style files is described here.)

Timeline for d6d3mj_: