Lineage for d1g20b_ (1g20 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008181Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1008223Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 1008267Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 1008268Species Azotobacter vinelandii [TaxId:354] [81397] (15 PDB entries)
  8. 1008283Domain d1g20b_: 1g20 B: [35614]
    Other proteins in same PDB: d1g20a_, d1g20c_, d1g20e_, d1g20f_, d1g20g_, d1g20h_
    complexed with ca, cfm, clf, hca, sf4

Details for d1g20b_

PDB Entry: 1g20 (more details), 2.2 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (B:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d1g20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g20b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d1g20b_:

Click to download the PDB-style file with coordinates for d1g20b_.
(The format of our PDB-style files is described here.)

Timeline for d1g20b_: