| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
| Protein automated matches [233094] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255752] (7 PDB entries) |
| Domain d5z86o2: 5z86 O:91-227 [356135] Other proteins in same PDB: d5z86a_, d5z86b1, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ automated match to d3ag3b2 complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z86 (more details), 1.85 Å
SCOPe Domain Sequences for d5z86o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z86o2 b.6.1.2 (O:91-227) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml
Timeline for d5z86o2:
View in 3DDomains from other chains: (mouse over for more information) d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ |