Lineage for d1g20a_ (1g20 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912425Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2912426Species Azotobacter vinelandii [TaxId:354] [81398] (29 PDB entries)
  8. 2912451Domain d1g20a_: 1g20 A: [35613]
    Other proteins in same PDB: d1g20b_, d1g20d_, d1g20e_, d1g20f_, d1g20g_, d1g20h_
    complexed with ca, cfm, clf, hca, sf4

Details for d1g20a_

PDB Entry: 1g20 (more details), 2.2 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d1g20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g20a_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d1g20a_:

Click to download the PDB-style file with coordinates for d1g20a_.
(The format of our PDB-style files is described here.)

Timeline for d1g20a_: