Lineage for d2mind_ (2min D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186038Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 186054Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 186071Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 186072Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 186073Species Azotobacter vinelandii [TaxId:354] [53819] (6 PDB entries)
  8. 186077Domain d2mind_: 2min D: [35612]

Details for d2mind_

PDB Entry: 2min (more details), 2.03 Å

PDB Description: nitrogenase mofe protein from azotobacter vinelandii, oxidized state
PDB Compounds: (D:)

SCOP Domain Sequences for d2mind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mind_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d2mind_:

Click to download the PDB-style file with coordinates for d2mind_.
(The format of our PDB-style files is described here.)

Timeline for d2mind_: