![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
![]() | Domain d5z86g_: 5z86 G: [356111] Other proteins in same PDB: d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ automated match to d3ag3g_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z86 (more details), 1.85 Å
SCOPe Domain Sequences for d5z86g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z86g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d5z86g_:
![]() Domains from other chains: (mouse over for more information) d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_ |