![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.2: Carboxypeptidase T [53198] (1 protein) automatically mapped to Pfam PF00246 |
![]() | Protein Carboxypeptidase T [53199] (1 species) |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [53200] (23 PDB entries) |
![]() | Domain d6f79a_: 6f79 A: [356101] automated match to d4gm5a_ complexed with 0x9, ca, so4, zn; mutant |
PDB Entry: 6f79 (more details), 1.9 Å
SCOPe Domain Sequences for d6f79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f79a_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta amrdfinsrvvggkqqiktlitfhtyseliqypygytytdvpsdmtqddfnvfktmantm aqtngytpqqasdlyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr nkeavlyvaekadcpysvigksc
Timeline for d6f79a_: