SCOPe 2.08: Domain d6f6qa_: 6f6q A:

Lineage for d6f6qa_ (6f6q A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.2: Carboxypeptidase T [53198] (1 protein)
   automatically mapped to Pfam PF00246

6. Protein Carboxypeptidase T [53199] (1 species)

7. Species Thermoactinomyces vulgaris [TaxId:2026] [53200] (23 PDB entries)

8. Domain d6f6qa_: 6f6q A: [356100]
   automated match to d4gm5a_
   complexed with 0x9, ca, so4, zn; mutant

Details for d6f6qa_

PDB Entry: 6f6q, 1.79 Å

PDB Description: carboxypeptidase t mutant l254n with sulphamoil arginine

PDB Compounds: (A:) carboxypeptidase t

SCOPe Domain Sequences for d6f6qa_:

Sequence; same for both SEQRES and ATOM records:

>d6f6qa_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]}
dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
aqtngytpqqasdnyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
nkeavlyvaekadcpysvigksc

Timeline for d6f6qa_:

• d6f6qa_ first appeared in SCOPe 2.07