Lineage for d6flwd_ (6flw D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813299Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2813300Protein automated matches [190516] (5 species)
    not a true protein
  7. 2813334Species Pineapple (Ananas comosus) [TaxId:4615] [356037] (3 PDB entries)
  8. 2813340Domain d6flwd_: 6flw D: [356095]
    automated match to d5gvya_
    complexed with cit

Details for d6flwd_

PDB Entry: 6flw (more details), 1.8 Å

PDB Description: structure of acmjrl, a mannose binding jacalin related lectin from ananas comosus.
PDB Compounds: (D:) Jacalin-like lectin

SCOPe Domain Sequences for d6flwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flwd_ b.77.3.0 (D:) automated matches {Pineapple (Ananas comosus) [TaxId: 4615]}
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy

SCOPe Domain Coordinates for d6flwd_:

Click to download the PDB-style file with coordinates for d6flwd_.
(The format of our PDB-style files is described here.)

Timeline for d6flwd_: