Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6ffje1: 6ffj E:9-124 [356083] Other proteins in same PDB: d6ffja3, d6ffjc3, d6ffje3, d6ffjg3 automated match to d5gruh1 |
PDB Entry: 6ffj (more details), 2.2 Å
SCOPe Domain Sequences for d6ffje1:
Sequence, based on SEQRES records: (download)
>d6ffje1 b.1.1.0 (E:9-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} aelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesnqkfkdka iltadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgttvtvs
>d6ffje1 b.1.1.0 (E:9-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} aelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesnqkfkdka iltadrssntafmylnsltsedsavyycarespyyyamdywgqgttvtvs
Timeline for d6ffje1: