Lineage for d6c7fa_ (6c7f A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. Protein automated matches [190983] (12 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. Domain d6c7fa_: 6c7f A: [356082]
    automated match to d5vp0b_
    complexed with eos, mg, zn

Details for d6c7fa_

PDB Entry: 6c7f (more details), 1.82 Å

PDB Description: crystal structure of human phosphodiesterase 2a with 1-(2-chloro-5- isobutoxy-phenyl)-n,4-dimethyl-[1,2,4]triazolo[4,3-a]quinoxaline-8- carboxamide
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6c7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7fa_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d6c7fa_ are not available.

Timeline for d6c7fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6c7fb_, d6c7fc_