Class b: All beta proteins [48724] (178 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (5 species) not a true protein |
Species Ananas comosus [TaxId:4615] [356037] (3 PDB entries) |
Domain d6flya_: 6fly A: [356078] automated match to d5gvya_ complexed with man |
PDB Entry: 6fly (more details), 2.75 Å
SCOPe Domain Sequences for d6flya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flya_ b.77.3.0 (A:) automated matches {Ananas comosus [TaxId: 4615]} sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas grivafygrfgslvdafgiylmpy
Timeline for d6flya_: