Lineage for d6h09a2 (6h09 A:148-219)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319709Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2319801Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2319802Protein automated matches [191156] (12 species)
    not a true protein
  7. 2319899Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries)
  8. 2319901Domain d6h09a2: 6h09 A:148-219 [356070]
    Other proteins in same PDB: d6h09a1
    automated match to d5hgna2
    complexed with ihp

Details for d6h09a2

PDB Entry: 6h09 (more details), 2 Å

PDB Description: hiv capsid hexamer with ip6 ligand
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d6h09a2:

Sequence, based on SEQRES records: (download)

>d6h09a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d6h09a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q

SCOPe Domain Coordinates for d6h09a2:

Click to download the PDB-style file with coordinates for d6h09a2.
(The format of our PDB-style files is described here.)

Timeline for d6h09a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h09a1