![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
![]() | Protein automated matches [191156] (12 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries) |
![]() | Domain d6h09a2: 6h09 A:148-219 [356070] Other proteins in same PDB: d6h09a1 automated match to d5hgna2 complexed with ihp |
PDB Entry: 6h09 (more details), 2 Å
SCOPe Domain Sequences for d6h09a2:
Sequence, based on SEQRES records: (download)
>d6h09a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacq
>d6h09a2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac q
Timeline for d6h09a2: