SCOPe 2.08: Domain d6h09a1: 6h09 A:1-147

Lineage for d6h09a1 (6h09 A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d6h09a1: 6h09 A:1-147 [356069]
   Other proteins in same PDB: d6h09a2
   automated match to d4u0ea1
   complexed with ihp

Details for d6h09a1

PDB Entry: 6h09, 2 Å

PDB Description: hiv capsid hexamer with ip6 ligand

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d6h09a1:

Sequence, based on SEQRES records:

>d6h09a1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d6h09a1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnpp
ipvgeiykrwiilglnkivrmysp

Timeline for d6h09a1:

• d6h09a1 first appeared in SCOPe 2.07