SCOPe 2.07: Domain d6gr0b_: 6gr0 B:

Lineage for d6gr0b_ (6gr0 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d6gr0b_: 6gr0 B: [356064]
   automated match to d4gh7a_
   complexed with f8w, ga

Details for d6gr0b_

PDB Entry: 6gr0, 2.5 Å

PDB Description: petrobactin-binding engineered lipocalin in complex with gallium- petrobactin

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d6gr0b_:

Sequence, based on SEQRES records:

>d6gr0b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
lipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksynv
tnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktv
vqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Sequence, based on observed residues (ATOM records):

>d6gr0b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
lipapplskvplqqnfqdnqfhgkwyvvgfaeniqdppkmiatiyelkedksynvtnvas
nwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffktvvqnre
kfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d6gr0b_:

• d6gr0b_ is new in SCOPe 2.07-stable
  
• d6gr0b_ appears in the current release, SCOPe 2.08