SCOPe 2.07: Domain d6gqzb_: 6gqz B:

Lineage for d6gqzb_ (6gqz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d6gqzb_: 6gqz B: [356060]
   automated match to d4gh7a_

Details for d6gqzb_

PDB Entry: 6gqz, 1.4 Å

PDB Description: petrobactin-binding engineered lipocalin without ligand

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d6gqzb_:

Sequence; same for both SEQRES and ATOM records:

>d6gqzb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfhgkwyvvgfaeniqqredkdppkmiatiyelkedksy
nvtnvasnwekctyriktfvpgsqpgeftlgeiksrpgmtsylvrvvstnynqhamvffk
tvvqnrekfwitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d6gqzb_:

• d6gqzb_ is new in SCOPe 2.07-stable
  
• d6gqzb_ appears in the current release, SCOPe 2.08