SCOPe 2.08: Domain d6fd4b_: 6fd4 B:

Lineage for d6fd4b_ (6fd4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)

8. Domain d6fd4b_: 6fd4 B: [356059]
   automated match to d1zn8b_
   complexed with mg, prp

Details for d6fd4b_

PDB Entry: 6fd4, 1.5 Å

PDB Description: crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 14 hours post crystallization

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d6fd4b_:

Sequence, based on SEQRES records:

>d6fd4b_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslefgkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

Sequence, based on observed residues (ATOM records):

>d6fd4b_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslgkaeleiqkdalepgqrvv
vvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

Timeline for d6fd4b_:

• d6fd4b_ first appeared in SCOPe 2.07