![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 |
![]() | Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species) both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 |
![]() | Species Clostridium pasteurianum [TaxId:1501] [81395] (1 PDB entry) |
![]() | Domain d1miod_: 1mio D: [35604] Other proteins in same PDB: d1mioa_, d1mioc_ complexed with ca, cfm, clp, hca |
PDB Entry: 1mio (more details), 3 Å
SCOPe Domain Sequences for d1miod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miod_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]} ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy npkvgykgairlveeitnvildkierecteedfevvr
Timeline for d1miod_: