SCOP 1.75: Domain d1miod_: 1mio D:

Lineage for d1miod_ (1mio D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3

6. Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3

7. Species Clostridium pasteurianum [TaxId:1501] [81395] (1 PDB entry)

8. Domain d1miod_: 1mio D: [35604]
   Other proteins in same PDB: d1mioa_, d1mioc_
   complexed with ca, cfm, clp, hca

Details for d1miod_

PDB Entry: 1mio, 3 Å

PDB Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution

PDB Compounds: (D:) nitrogenase molybdenum iron protein (beta chain)

SCOP Domain Sequences for d1miod_:

Sequence; same for both SEQRES and ATOM records:

>d1miod_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]}
ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
npkvgykgairlveeitnvildkierecteedfevvr

Timeline for d1miod_:

• d1miod_ first appeared (with stable ids) in SCOP 1.55
  
• d1miod_ appears in SCOP 1.73
  
• d1miod_ appears in SCOPe 2.01
  
• d1miod_ appears in the current release, SCOPe 2.08