Lineage for d6ffjc1 (6ffj C:9-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756868Domain d6ffjc1: 6ffj C:9-125 [356039]
    Other proteins in same PDB: d6ffja3, d6ffjc3, d6ffje3, d6ffjg3
    automated match to d5gruh1

Details for d6ffjc1

PDB Entry: 6ffj (more details), 2.2 Å

PDB Description: anti-tumor antibody 14f7-derived single chain fragment variable (scfv)
PDB Compounds: (C:) 14F7-derived scFv

SCOPe Domain Sequences for d6ffjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ffjc1 b.1.1.0 (C:9-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesnqkfkdka
iltadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgttvtvss

SCOPe Domain Coordinates for d6ffjc1:

Click to download the PDB-style file with coordinates for d6ffjc1.
(The format of our PDB-style files is described here.)

Timeline for d6ffjc1: