Lineage for d1mioc_ (1mio C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127919Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 127935Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 127948Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 127949Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 127971Species Clostridium pasteurianum [TaxId:1501] [53818] (1 PDB entry)
  8. 127974Domain d1mioc_: 1mio C: [35603]

Details for d1mioc_

PDB Entry: 1mio (more details), 3 Å

PDB Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution
PDB Compounds: (C:)

SCOP Domain Sequences for d1mioc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mioc_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Clostridium pasteurianum}
senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses

SCOP Domain Coordinates for d1mioc_:

Click to download the PDB-style file with coordinates for d1mioc_.
(The format of our PDB-style files is described here.)

Timeline for d1mioc_: