Lineage for d6d3hm_ (6d3h M:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. Protein automated matches [191281] (21 species)
    not a true protein
  7. Species Sphingobium herbicidovorans [TaxId:76947] [355993] (3 PDB entries)
  8. Domain d6d3hm_: 6d3h M: [356026]
    automated match to d1otjb_
    complexed with akg, cl, co, ftv

Details for d6d3hm_

PDB Entry: 6d3h (more details), 2.03 Å

PDB Description: ft_t dioxygenase with bound dichlorprop
PDB Compounds: (M:) FT_T dioxygenase

SCOPe Domain Sequences for d6d3hm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d3hm_ b.82.2.0 (M:) automated matches {Sphingobium herbicidovorans [TaxId: 76947]}
tnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhi
afsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmra
ievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvk
vmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfd
ftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr

SCOPe Domain Coordinates for d6d3hm_ are not available.

Timeline for d6d3hm_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6d3ha_, d6d3hb_, d6d3hi_