Lineage for d1mioa_ (1mio A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75090Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 75106Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 75119Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 75120Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 75142Species Clostridium pasteurianum [TaxId:1501] [53818] (1 PDB entry)
  8. 75143Domain d1mioa_: 1mio A: [35601]

Details for d1mioa_

PDB Entry: 1mio (more details), 3 Å

PDB Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution

SCOP Domain Sequences for d1mioa_:

Sequence, based on SEQRES records: (download)

>d1mioa_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Clostridium pasteurianum}
senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses

Sequence, based on observed residues (ATOM records): (download)

>d1mioa_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Clostridium pasteurianum}
senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
vplsayggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses

SCOP Domain Coordinates for d1mioa_:

Click to download the PDB-style file with coordinates for d1mioa_.
(The format of our PDB-style files is described here.)

Timeline for d1mioa_: