Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries) |
Domain d6c7ea1: 6c7e A:579-917 [356009] Other proteins in same PDB: d6c7ea2, d6c7eb2 automated match to d5vp0b_ complexed with eog, mg, zn |
PDB Entry: 6c7e (more details), 1.43 Å
SCOPe Domain Sequences for d6c7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c7ea1 a.211.1.0 (A:579-917) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf pkaaelyervasnrehwtkvshkftirglpsnnsldfld
Timeline for d6c7ea1:
View in 3D Domains from other chains: (mouse over for more information) d6c7eb1, d6c7eb2, d6c7ec_, d6c7ed_ |