Lineage for d6d3ja_ (6d3j A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2405395Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2405396Protein automated matches [191281] (20 species)
    not a true protein
  7. 3055931Species Sphingobium herbicidovorans [TaxId:76947] [355993] (3 PDB entries)
  8. 3055932Domain d6d3ja_: 6d3j A: [355994]
    automated match to d1otjb_
    complexed with akg, co

Details for d6d3ja_

PDB Entry: 6d3j (more details), 3 Å

PDB Description: ft_t dioxygenase holoenzyme
PDB Compounds: (A:) FT_T dioxygenase

SCOPe Domain Sequences for d6d3ja_:

Sequence, based on SEQRES records: (download)

>d6d3ja_ b.82.2.0 (A:) automated matches {Sphingobium herbicidovorans [TaxId: 76947]}
nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr

Sequence, based on observed residues (ATOM records): (download)

>d6d3ja_ b.82.2.0 (A:) automated matches {Sphingobium herbicidovorans [TaxId: 76947]}
nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
fsrrfgpvdpvpilksiegypevqmirigddwhtdstfldappaavvmraievpeyggdt
gflsmysawetlsptmqatieglnvvhsaetvhplvvthpvtgrralycnqvycqkiqgm
tdaesksllqflyehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttv
agdkpsr

SCOPe Domain Coordinates for d6d3ja_:

Click to download the PDB-style file with coordinates for d6d3ja_.
(The format of our PDB-style files is described here.)

Timeline for d6d3ja_:

  • d6d3ja_ is new in SCOPe 2.07-stable