| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
| Family c.92.2.2: TroA-like [53811] (6 proteins) |
| Protein Periplasmic zinc binding protein TroA [53812] (1 species) |
| Species Treponema pallidum [TaxId:160] [53813] (2 PDB entries) |
| Domain d1toab_: 1toa B: [35599] complexed with gol, zn |
PDB Entry: 1toa (more details), 1.8 Å
SCOPe Domain Sequences for d1toab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1toab_ c.92.2.2 (B:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]}
gkplvvttigmiadavkniaqgdvhlkglmgpgvdphlytatagdvewlgnadlilyngl
hletkmgevfsklrgsrlvvavsetipvsqrlsleeaefdphvwfdvklwsysvkavyes
lckllpgktreftqryqayqqqldkldayvrrkaqslpaerrvlvtahdafgyfsraygf
evkglqgvstaseasahdmqelaafiaqrklpaifiessiphknvealrdavqarghvvq
iggelfsdamgdagtsegtyvgmvthnidtivaalar
Timeline for d1toab_: