Lineage for d6c9wb_ (6c9w B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Llama (Lama glama) [TaxId:9844] [187485] (227 PDB entries)
  8. Domain d6c9wb_: 6c9w B: [355989]
    Other proteins in same PDB: d6c9wa_
    automated match to d4ocmc_
    complexed with 9pg, bng

Details for d6c9wb_

PDB Entry: 6c9w (more details), 3 Å

PDB Description: crystal structure of a ligand bound lacy/nanobody complex
PDB Compounds: (B:) Nanobody9047

SCOPe Domain Sequences for d6c9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c9wb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscaasggtfstfnmgwfrqdlgkerefvaairwtggrayyg
dsvkgrftisrdnakntvylqmnslkpedtavyycarqgtngggyseatsynywgqgtqv
tvssh

SCOPe Domain Coordinates for d6c9wb_ are not available.

Timeline for d6c9wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6c9wa_