SCOPe 2.08: Domain d6c9wb_: 6c9w B:

Lineage for d6c9wb_ (6c9w B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6c9wb_: 6c9w B: [355989]
   Other proteins in same PDB: d6c9wa_
   automated match to d4ocmc_
   complexed with 9pg, bng

Details for d6c9wb_

PDB Entry: 6c9w, 3 Å

PDB Description: crystal structure of a ligand bound lacy/nanobody complex

PDB Compounds: (B:) Nanobody9047

SCOPe Domain Sequences for d6c9wb_:

Sequence; same for both SEQRES and ATOM records:

>d6c9wb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscaasggtfstfnmgwfrqdlgkerefvaairwtggrayyg
dsvkgrftisrdnakntvylqmnslkpedtavyycarqgtngggyseatsynywgqgtqv
tvssh

Timeline for d6c9wb_:

• d6c9wb_ first appeared in SCOPe 2.07