Lineage for d6c9wa_ (6c9w A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. Superfamily f.38.1: MFS general substrate transporter [103473] (5 families) (S)
  5. Family f.38.1.2: LacY-like proton/sugar symporter [103477] (2 proteins)
    automatically mapped to Pfam PF07690
    automatically mapped to Pfam PF01306
  6. Protein automated matches [190249] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [355986] (1 PDB entry)
  8. Domain d6c9wa_: 6c9w A: [355987]
    Other proteins in same PDB: d6c9wb_
    automated match to d1pv7a_
    complexed with 9pg, bng

Details for d6c9wa_

PDB Entry: 6c9w (more details), 3 Å

PDB Description: crystal structure of a ligand bound lacy/nanobody complex
PDB Compounds: (A:) lactose permease

SCOPe Domain Sequences for d6c9wa_:

Sequence, based on SEQRES records: (download)

>d6c9wa_ f.38.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtwiifaaislfsllfqpl
fgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfnaga
paveafiekvsrrsnfefgrarmfgcvgwalcasivgimftinnqfvfwlgsgcalilav
llffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfdqq
fanfftsffatgeqgtrvfwyvttmgellnasimffapliinriggknalllagtimsvr
iigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkqlam
ifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsl

Sequence, based on observed residues (ATOM records): (download)

>d6c9wa_ f.38.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtwiifaaislfsllfqpl
fgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfnaga
paveafiekvsrrsnfefgrarmfgcvgwalcasivgimftinnqfvfwlgsgcalilav
llffaktdapsshsafslklalelfrqpklwflslyvigvsctydvfdqqfanfftsffa
tgeqgtrvfwyvttmgellnasimffapliinriggknalllagtimsvriigssfatsa
levvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkqlamifmsvlagnm
yesigfqgaylvlglvalgftlisvftlsgpgplsl

SCOPe Domain Coordinates for d6c9wa_ are not available.

Timeline for d6c9wa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6c9wb_