Lineage for d6c7da1 (6c7d A:579-917)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (127 PDB entries)
  8. 3055921Domain d6c7da1: 6c7d A:579-917 [355983]
    Other proteins in same PDB: d6c7da2, d6c7db2
    automated match to d5vp0b_
    complexed with eoj, mg, zn

Details for d6c7da1

PDB Entry: 6c7d (more details), 1.79 Å

PDB Description: crystal structure of human phosphodiesterase 2a with n-(1-adamantyl)- 1-(2-chlorophenyl)-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline-8- carboxamide
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6c7da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7da1 a.211.1.0 (A:579-917) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d6c7da1:

Click to download the PDB-style file with coordinates for d6c7da1.
(The format of our PDB-style files is described here.)

Timeline for d6c7da1:

  • d6c7da1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-15