Lineage for d6gwra1 (6gwr A:601-912)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2985937Domain d6gwra1: 6gwr A:601-912 [355972]
    Other proteins in same PDB: d6gwra2
    automated match to d3zosa_
    complexed with edo, few, so4

Details for d6gwra1

PDB Entry: 6gwr (more details), 2.07 Å

PDB Description: structure of the kinase domain of human ddr1 in complex with a potent and selective inhibitor of ddr1 and ddr2
PDB Compounds: (A:) epithelial discoidin domain-containing receptor 1

SCOPe Domain Sequences for d6gwra1:

Sequence, based on SEQRES records: (download)

>d6gwra1 d.144.1.0 (A:601-912) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilrpd
atknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqled
kaaegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenfti
kiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlc
raqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsq
lhrflaedalnt

Sequence, based on observed residues (ATOM records): (download)

>d6gwra1 d.144.1.0 (A:601-912) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplghpllvavkilrpdatkn
arndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledkaae
qgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnlya
gdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqv
ienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaedalnt

SCOPe Domain Coordinates for d6gwra1:

Click to download the PDB-style file with coordinates for d6gwra1.
(The format of our PDB-style files is described here.)

Timeline for d6gwra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gwra2
View in 3D
Domains from other chains:
(mouse over for more information)
d6gwrb_