Lineage for d1efdn_ (1efd N:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484691Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2484798Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2484799Family c.92.2.1: Periplasmic ferric siderophore binding protein FhuD [53808] (1 protein)
    automatically mapped to Pfam PF01497
  6. 2484800Protein Periplasmic ferric siderophore binding protein FhuD [53809] (1 species)
  7. 2484801Species Escherichia coli [TaxId:562] [53810] (4 PDB entries)
  8. 2484802Domain d1efdn_: 1efd N: [35597]
    complexed with gallichrome
    complexed with gcr

Details for d1efdn_

PDB Entry: 1efd (more details), 1.9 Å

PDB Description: periplasmic ferric siderophore binding protein fhud complexed with gallichrome
PDB Compounds: (N:) ferrichrome-binding periplasmic protein

SCOPe Domain Sequences for d1efdn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efdn_ c.92.2.1 (N:) Periplasmic ferric siderophore binding protein FhuD {Escherichia coli [TaxId: 562]}
gidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlel
ltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaa
ethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawq
getnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpa
vwfygatlsamhfvrvldnaig

SCOPe Domain Coordinates for d1efdn_:

Click to download the PDB-style file with coordinates for d1efdn_.
(The format of our PDB-style files is described here.)

Timeline for d1efdn_: