Lineage for d6fl2b1 (6fl2 B:1-299)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950273Species Klebsiella pneumoniae [TaxId:573] [355716] (12 PDB entries)
  8. 2950277Domain d6fl2b1: 6fl2 B:1-299 [355958]
    Other proteins in same PDB: d6fl2a2, d6fl2b2, d6fl2b3
    automated match to d5vj0a_
    complexed with gol, hem, mg, no2

Details for d6fl2b1

PDB Entry: 6fl2 (more details), 1.27 Å

PDB Description: crystal structure of a dye-decolorizing peroxidase d143a variant from klebsiella pneumoniae (kpdyp)
PDB Compounds: (B:) Iron-dependent peroxidase

SCOPe Domain Sequences for d6fl2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fl2b1 d.58.4.0 (B:1-299) automated matches {Klebsiella pneumoniae [TaxId: 573]}
msqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavvafg
nnvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaafgda
idvkeeihgfrwveerdlsgfvagtenpageetrrevavikdgvdaggsyvfvqrwehnl
kqlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivrqslpygta
sgthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriqal

SCOPe Domain Coordinates for d6fl2b1:

Click to download the PDB-style file with coordinates for d6fl2b1.
(The format of our PDB-style files is described here.)

Timeline for d6fl2b1: