Lineage for d5nrnb_ (5nrn B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein Thymidylate kinase [52563] (5 species)
  7. Species Mycobacterium tuberculosis [TaxId:83332] [346929] (5 PDB entries)
  8. Domain d5nrnb_: 5nrn B: [355956]
    automated match to d1gsia_
    complexed with 95w, cl

Details for d5nrnb_

PDB Entry: 5nrn (more details), 2.2 Å

PDB Description: mtb tmk crystal structure in complex with compound 3
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5nrnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nrnb_ c.37.1.1 (B:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 83332]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatlappd

SCOPe Domain Coordinates for d5nrnb_ are not available.

Timeline for d5nrnb_:

Domains from other chains:
(mouse over for more information)
d5nrna_